TGM4 polyclonal antibody
  • TGM4 polyclonal antibody

TGM4 polyclonal antibody

Ref: AB-PAB25811
TGM4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TGM4.
Información adicional
Size 100 uL
Gene Name TGM4
Gene Alias FLJ26776|TGP|hTGP
Gene Description transglutaminase 4 (prostate)
Storage Conditions Store at -20C. For long term storage store at -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.05 mg/mL
Application Key IHC-P
Immunogen Prot. Seq SVNFTVILKRKTAALQNVNILGSFELQLYTGKKMAKLCDLNKTSQIQGQVSEVTLTLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TGM4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7047
Iso type IgG

Enviar uma mensagem


TGM4 polyclonal antibody

TGM4 polyclonal antibody