THOC2 polyclonal antibody
  • THOC2 polyclonal antibody

THOC2 polyclonal antibody

Ref: AB-PAB24546
THOC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THOC2.
Información adicional
Size 100 uL
Gene Name THOC2
Gene Alias CXorf3|THO2|dJ506G2.1
Gene Description THO complex 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKDPPPRNAVASV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THOC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57187
Iso type IgG

Enviar uma mensagem


THOC2 polyclonal antibody

THOC2 polyclonal antibody