KIAA1407 polyclonal antibody
  • KIAA1407 polyclonal antibody

KIAA1407 polyclonal antibody

Ref: AB-PAB24544
KIAA1407 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1407.
Información adicional
Size 100 uL
Gene Name KIAA1407
Gene Alias FLJ43314
Gene Description KIAA1407
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KVMFQSTHILPDEEKMVKERKRKLKEVLIQTFKENQQCQKRYFAAWHKLILDHRIKLGKAGTLSDWKIQLKVLRAWRDYTRFQKLERETQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1407.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57577
Iso type IgG

Enviar uma mensagem


KIAA1407 polyclonal antibody

KIAA1407 polyclonal antibody