CNPY1 polyclonal antibody
  • CNPY1 polyclonal antibody

CNPY1 polyclonal antibody

Ref: AB-PAB24533
CNPY1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNPY1.
Información adicional
Size 100 uL
Gene Name CNPY1
Gene Alias MGC125606
Gene Description canopy 1 homolog (zebrafish)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANH
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNPY1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285888
Iso type IgG

Enviar uma mensagem


CNPY1 polyclonal antibody

CNPY1 polyclonal antibody