MRPL20 polyclonal antibody
  • MRPL20 polyclonal antibody

MRPL20 polyclonal antibody

Ref: AB-PAB24526
MRPL20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL20.
Información adicional
Size 100 uL
Gene Name MRPL20
Gene Alias L20mt|MGC4779|MGC74465|MRP-L20
Gene Description mitochondrial ribosomal protein L20
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPL20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55052
Iso type IgG

Enviar uma mensagem


MRPL20 polyclonal antibody

MRPL20 polyclonal antibody