SCAF1 polyclonal antibody
  • SCAF1 polyclonal antibody

SCAF1 polyclonal antibody

Ref: AB-PAB24516
SCAF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCAF1.
Información adicional
Size 100 uL
Gene Name SCAF1
Gene Alias FLJ00034|SR-A1|SRA1
Gene Description SR-related CTD-associated factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCAF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 58506
Iso type IgG

Enviar uma mensagem


SCAF1 polyclonal antibody

SCAF1 polyclonal antibody