CCNYL1 polyclonal antibody
  • CCNYL1 polyclonal antibody

CCNYL1 polyclonal antibody

Ref: AB-PAB24515
CCNYL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCNYL1.
Información adicional
Size 100 uL
Gene Name CCNYL1
Gene Alias FLJ40432
Gene Description cyclin Y-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GSAELYCASDIYEAVSGDAVAVAPAVVEPAELDFGEGEGHHLQHISDREMPEDLALES
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCNYL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 151195
Iso type IgG

Enviar uma mensagem


CCNYL1 polyclonal antibody

CCNYL1 polyclonal antibody