IGSF11 polyclonal antibody
  • IGSF11 polyclonal antibody

IGSF11 polyclonal antibody

Ref: AB-PAB24502
IGSF11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IGSF11.
Información adicional
Size 100 uL
Gene Name IGSF11
Gene Alias BT-IgSF|CXADRL1|Igsf13|MGC35227|VSIG3
Gene Description immunoglobulin superfamily, member 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IGSF11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 152404
Iso type IgG

Enviar uma mensagem


IGSF11 polyclonal antibody

IGSF11 polyclonal antibody