C3orf75 polyclonal antibody
  • C3orf75 polyclonal antibody

C3orf75 polyclonal antibody

Ref: AB-PAB24499
C3orf75 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C3orf75.
Información adicional
Size 100 uL
Gene Name C3orf75
Gene Alias FLJ20211|TMEM103
Gene Description chromosome 3 open reading frame 75
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C3orf75.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54859
Iso type IgG

Enviar uma mensagem


C3orf75 polyclonal antibody

C3orf75 polyclonal antibody