FAM160A1 polyclonal antibody
  • FAM160A1 polyclonal antibody

FAM160A1 polyclonal antibody

Ref: AB-PAB24496
FAM160A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM160A1.
Información adicional
Size 100 uL
Gene Name FAM160A1
Gene Alias FLJ43373
Gene Description family with sequence similarity 160, member A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLHHKPILKPLMMLLSSCSGTTTPTVEEKLVVLLNQLCSILAKDPSILELFFHTSEDQGAANFLIFS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM160A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 729830
Iso type IgG

Enviar uma mensagem


FAM160A1 polyclonal antibody

FAM160A1 polyclonal antibody