C16orf42 polyclonal antibody
  • C16orf42 polyclonal antibody

C16orf42 polyclonal antibody

Ref: AB-PAB24489
C16orf42 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf42.
Información adicional
Size 100 uL
Gene Name C16orf42
Gene Alias MGC24381
Gene Description chromosome 16 open reading frame 42
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FLANAKESPQEEEIDPFDVDSGREFGNPNRPVASTRLPSDTDDSDASEDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf42.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 115939
Iso type IgG

Enviar uma mensagem


C16orf42 polyclonal antibody

C16orf42 polyclonal antibody