FAM173A polyclonal antibody
  • FAM173A polyclonal antibody

FAM173A polyclonal antibody

Ref: AB-PAB24488
FAM173A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM173A.
Información adicional
Size 100 uL
Gene Name FAM173A
Gene Alias C16orf24|MGC2494
Gene Description family with sequence similarity 173, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CAGSVCYRRKDLWKVSLRDCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAASSRIPIQAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM173A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65990
Iso type IgG

Enviar uma mensagem


FAM173A polyclonal antibody

FAM173A polyclonal antibody