BEST2 polyclonal antibody
  • BEST2 polyclonal antibody

BEST2 polyclonal antibody

Ref: AB-PAB24487
BEST2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BEST2.
Información adicional
Size 100 uL
Gene Name BEST2
Gene Alias FLJ20132|VMD2L1
Gene Description bestrophin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BEST2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54831
Iso type IgG

Enviar uma mensagem


BEST2 polyclonal antibody

BEST2 polyclonal antibody