KIAA0528 polyclonal antibody
  • KIAA0528 polyclonal antibody

KIAA0528 polyclonal antibody

Ref: AB-PAB24480
KIAA0528 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0528.
Información adicional
Size 100 uL
Gene Name KIAA0528
Gene Alias DKFZp779N2044
Gene Description KIAA0528
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IHNPDEPETRDAWWAEIRQEIKSHAKALGCHAVVGYSESTSICEEVCILSASGTAAVLNPRFLQDGTVEGCLEQRLEENLPTRCGFC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0528.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9847
Iso type IgG

Enviar uma mensagem


KIAA0528 polyclonal antibody

KIAA0528 polyclonal antibody