LRRIQ1 polyclonal antibody
  • LRRIQ1 polyclonal antibody

LRRIQ1 polyclonal antibody

Ref: AB-PAB24476
LRRIQ1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRIQ1.
Información adicional
Size 100 uL
Gene Name LRRIQ1
Gene Alias FLJ12303
Gene Description leucine-rich repeats and IQ motif containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRIQ1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84125
Iso type IgG

Enviar uma mensagem


LRRIQ1 polyclonal antibody

LRRIQ1 polyclonal antibody