C6orf223 polyclonal antibody
  • C6orf223 polyclonal antibody

C6orf223 polyclonal antibody

Ref: AB-PAB24471
C6orf223 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf223.
Información adicional
Size 100 uL
Gene Name C6orf223
Gene Alias MGC45491
Gene Description chromosome 6 open reading frame 223
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C6orf223.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221416
Iso type IgG

Enviar uma mensagem


C6orf223 polyclonal antibody

C6orf223 polyclonal antibody