ANAPC13 polyclonal antibody
  • ANAPC13 polyclonal antibody

ANAPC13 polyclonal antibody

Ref: AB-PAB24470
ANAPC13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANAPC13.
Información adicional
Size 100 uL
Gene Name ANAPC13
Gene Alias APC13|DKFZp566D193|SWM1
Gene Description anaphase promoting complex subunit 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANAPC13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25847
Iso type IgG

Enviar uma mensagem


ANAPC13 polyclonal antibody

ANAPC13 polyclonal antibody