HNRPLL polyclonal antibody
  • HNRPLL polyclonal antibody

HNRPLL polyclonal antibody

Ref: AB-PAB24468
HNRPLL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HNRPLL.
Información adicional
Size 100 uL
Gene Name HNRPLL
Gene Alias SRRF
Gene Description heterogeneous nuclear ribonucleoprotein L-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDAKPSAKTLSGLLEWECKTD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HNRPLL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92906
Iso type IgG

Enviar uma mensagem


HNRPLL polyclonal antibody

HNRPLL polyclonal antibody