LYPLAL1 polyclonal antibody
  • LYPLAL1 polyclonal antibody

LYPLAL1 polyclonal antibody

Ref: AB-PAB24451
LYPLAL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LYPLAL1.
Información adicional
Size 100 uL
Gene Name LYPLAL1
Gene Alias FLJ99730|KIAA1238
Gene Description lysophospholipase-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LYPLAL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 127018
Iso type IgG

Enviar uma mensagem


LYPLAL1 polyclonal antibody

LYPLAL1 polyclonal antibody