SPANXN4 polyclonal antibody
  • SPANXN4 polyclonal antibody

SPANXN4 polyclonal antibody

Ref: AB-PAB24443
SPANXN4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPANXN4.
Información adicional
Size 100 uL
Gene Name SPANXN4
Gene Alias SPANX-N4
Gene Description SPANX family, member N4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KEKGDLDISAGSPQDGEEEKDLVFLGARACLEEHIRRSVLYVGDSDTLSKMKTSESPPSGHIPQSGVFCNSPNAV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPANXN4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 441525
Iso type IgG

Enviar uma mensagem


SPANXN4 polyclonal antibody

SPANXN4 polyclonal antibody