CCDC36 polyclonal antibody
  • CCDC36 polyclonal antibody

CCDC36 polyclonal antibody

Ref: AB-PAB24441
CCDC36 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC36.
Información adicional
Size 100 uL
Gene Name CCDC36
Gene Alias FLJ25320
Gene Description coiled-coil domain containing 36
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GEFIEMKSNLKHLEVLVAQQSQEFQQLCEQLGQLNVPSVLAELKRLISVPPVKDSASQTSPPLAQSLNLTRQEKYTSEKPVLWQAQALPAAWNPGMGSLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC36.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339834
Iso type IgG

Enviar uma mensagem


CCDC36 polyclonal antibody

CCDC36 polyclonal antibody