SLC25A37 polyclonal antibody
  • SLC25A37 polyclonal antibody

SLC25A37 polyclonal antibody

Ref: AB-PAB24440
SLC25A37 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC25A37.
Información adicional
Size 100 uL
Gene Name SLC25A37
Gene Alias HT015|MFRN|MSC|MSCP|PRO1278|PRO1584|PRO2217
Gene Description solute carrier family 25, member 37
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ARRMDGDSRDGGGGKDATGSEDYENLPTSASV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC25A37.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51312
Iso type IgG

Enviar uma mensagem


SLC25A37 polyclonal antibody

SLC25A37 polyclonal antibody