PATE4 polyclonal antibody
  • PATE4 polyclonal antibody

PATE4 polyclonal antibody

Ref: AB-PAB24437
PATE4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PATE4.
Información adicional
Size 100 uL
Gene Name PATE4
Gene Alias FLJ41047|PATE-B
Gene Description prostate and testis expressed 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCGDRNFCNVF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PATE4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 399968
Iso type IgG

Enviar uma mensagem


PATE4 polyclonal antibody

PATE4 polyclonal antibody