OR8S1 polyclonal antibody
  • OR8S1 polyclonal antibody

OR8S1 polyclonal antibody

Ref: AB-PAB24431
OR8S1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OR8S1.
Información adicional
Size 100 uL
Gene Name OR8S1
Gene Alias -
Gene Description olfactory receptor, family 8, subfamily S, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OR8S1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 341568
Iso type IgG

Enviar uma mensagem


OR8S1 polyclonal antibody

OR8S1 polyclonal antibody