FAM166B polyclonal antibody
  • FAM166B polyclonal antibody

FAM166B polyclonal antibody

Ref: AB-PAB24422
FAM166B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM166B.
Información adicional
Size 100 uL
Gene Name FAM166B
Gene Alias MGC157846
Gene Description family with sequence similarity 166, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RAQFIFAKNCSQVWAEALSDFTHLHEKQGSEELPKEAKGRKDTEKDQVPEPEGQLEEPTLEVVEQASPYSMDDRDPRKFFMSGFTGYVPCARFLFGSSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM166B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 730112
Iso type IgG

Enviar uma mensagem


FAM166B polyclonal antibody

FAM166B polyclonal antibody