NYAP2 polyclonal antibody
  • NYAP2 polyclonal antibody

NYAP2 polyclonal antibody

Ref: AB-PAB24421
NYAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NYAP2.
Información adicional
Size 100 uL
Gene Name NYAP2
Gene Alias KIAA1486
Gene Description neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PVLENVSYMKQPAGASPSTLPSHVPGHAKLEKEQAAALGPASATPALSSSPPPPSTLYRTQSPHGYPKSHSTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NYAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57624
Iso type IgG

Enviar uma mensagem


NYAP2 polyclonal antibody

NYAP2 polyclonal antibody