NXNL2 polyclonal antibody
  • NXNL2 polyclonal antibody

NXNL2 polyclonal antibody

Ref: AB-PAB24420
NXNL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NXNL2.
Información adicional
Size 100 uL
Gene Name NXNL2
Gene Alias C9orf121
Gene Description nucleoredoxin-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EMLDFMRELHGAWLALPFHDPYRHELRKRYNVTAIPKLVIVKQNGEVITNKGRKQIRERGLACFQDWVEAADIFQN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NXNL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158046
Iso type IgG

Enviar uma mensagem


NXNL2 polyclonal antibody

NXNL2 polyclonal antibody