EID2 polyclonal antibody
  • EID2 polyclonal antibody

EID2 polyclonal antibody

Ref: AB-PAB24418
EID2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EID2.
Información adicional
Size 100 uL
Gene Name EID2
Gene Alias CRI2|EID-2|MGC20452
Gene Description EP300 interacting inhibitor of differentiation 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EID2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 163126
Iso type IgG

Enviar uma mensagem


EID2 polyclonal antibody

EID2 polyclonal antibody