MRPS26 polyclonal antibody
  • MRPS26 polyclonal antibody

MRPS26 polyclonal antibody

Ref: AB-PAB24417
MRPS26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPS26.
Información adicional
Size 100 uL
Gene Name MRPS26
Gene Alias C20orf193|GI008|MRP-S13|MRP-S26|MRPS13|NY-BR-87|RPMS13|dJ534B8.3
Gene Description mitochondrial ribosomal protein S26
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq EVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPS26.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64949
Iso type IgG

Enviar uma mensagem


MRPS26 polyclonal antibody

MRPS26 polyclonal antibody