TXLNA polyclonal antibody
  • TXLNA polyclonal antibody

TXLNA polyclonal antibody

Ref: AB-PAB24408
TXLNA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXLNA.
Información adicional
Size 100 uL
Gene Name TXLNA
Gene Alias DKFZp451J0118|IL14|MGC118870|MGC118871|RP4-622L5.4|TXLN
Gene Description taxilin alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TXLNA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200081
Iso type IgG

Enviar uma mensagem


TXLNA polyclonal antibody

TXLNA polyclonal antibody