UBXN2B polyclonal antibody
  • UBXN2B polyclonal antibody

UBXN2B polyclonal antibody

Ref: AB-PAB24405
UBXN2B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UBXN2B.
Información adicional
Size 100 uL
Gene Name UBXN2B
Gene Alias p37
Gene Description UBX domain protein 2B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHEYSGLNIVRPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UBXN2B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 137886
Iso type IgG

Enviar uma mensagem


UBXN2B polyclonal antibody

UBXN2B polyclonal antibody