C9orf142 polyclonal antibody
  • C9orf142 polyclonal antibody

C9orf142 polyclonal antibody

Ref: AB-PAB24403
C9orf142 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf142.
Información adicional
Size 100 uL
Gene Name C9orf142
Gene Alias -
Gene Description chromosome 9 open reading frame 142
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf142.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286257
Iso type IgG

Enviar uma mensagem


C9orf142 polyclonal antibody

C9orf142 polyclonal antibody