SCRT1 polyclonal antibody
  • SCRT1 polyclonal antibody

SCRT1 polyclonal antibody

Ref: AB-PAB24402
SCRT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCRT1.
Información adicional
Size 100 uL
Gene Name SCRT1
Gene Alias DKFZp547F072|SCRT
Gene Description scratch homolog 1, zinc finger protein (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCRT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83482
Iso type IgG

Enviar uma mensagem


SCRT1 polyclonal antibody

SCRT1 polyclonal antibody