C2orf69 polyclonal antibody
  • C2orf69 polyclonal antibody

C2orf69 polyclonal antibody

Ref: AB-PAB24397
C2orf69 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C2orf69.
Información adicional
Size 100 uL
Gene Name C2orf69
Gene Alias FLJ38973
Gene Description chromosome 2 open reading frame 69
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C2orf69.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 205327
Iso type IgG

Enviar uma mensagem


C2orf69 polyclonal antibody

C2orf69 polyclonal antibody