C2orf56 polyclonal antibody
  • C2orf56 polyclonal antibody

C2orf56 polyclonal antibody

Ref: AB-PAB24396
C2orf56 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C2orf56.
Información adicional
Size 100 uL
Gene Name C2orf56
Gene Alias PRO1853
Gene Description chromosome 2 open reading frame 56
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C2orf56.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55471
Iso type IgG

Enviar uma mensagem


C2orf56 polyclonal antibody

C2orf56 polyclonal antibody