TMEM74B polyclonal antibody
  • TMEM74B polyclonal antibody

TMEM74B polyclonal antibody

Ref: AB-PAB24395
TMEM74B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM74B.
Información adicional
Size 100 uL
Gene Name TMEM74B
Gene Alias RP4-545L17.8|C20orf46
Gene Description transmembrane protein 74B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM74B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55321
Iso type IgG

Enviar uma mensagem


TMEM74B polyclonal antibody

TMEM74B polyclonal antibody