HM13 polyclonal antibody
  • HM13 polyclonal antibody

HM13 polyclonal antibody

Ref: AB-PAB24385
HM13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HM13.
Información adicional
Size 100 uL
Gene Name HM13
Gene Alias H13|IMP1|IMPAS|MSTP086|PSENL3|PSL3|SPP|dJ324O17.1
Gene Description histocompatibility (minor) 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HM13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81502
Iso type IgG

Enviar uma mensagem


HM13 polyclonal antibody

HM13 polyclonal antibody