PROX2 polyclonal antibody
  • PROX2 polyclonal antibody

PROX2 polyclonal antibody

Ref: AB-PAB24383
PROX2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PROX2.
Información adicional
Size 100 uL
Gene Name PROX2
Gene Alias FLJ36749
Gene Description prospero homeobox 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLLDPPGHLTQLGRSFQGQVAEGRSEPSPPVGGACKDPLALAALPRRVQLQAGVPVGNLSLAKRLDSPRYPIPPRMTPKPCQDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PROX2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283571
Iso type IgG

Enviar uma mensagem


PROX2 polyclonal antibody

PROX2 polyclonal antibody