C2orf72 polyclonal antibody
  • C2orf72 polyclonal antibody

C2orf72 polyclonal antibody

Ref: AB-PAB24375
C2orf72 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C2orf72.
Información adicional
Size 100 uL
Gene Name C2orf72
Gene Alias -
Gene Description chromosome 2 open reading frame 72
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GQPVEGAWERPGLPGLLACFSWGPWSRRKNQDVAACRSSAQEDFQEPEEELPLTAIFPNGDCDDLGRGSKACDGVVHTPAEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C2orf72.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 257407
Iso type IgG

Enviar uma mensagem


C2orf72 polyclonal antibody

C2orf72 polyclonal antibody