ABCA8 polyclonal antibody
  • ABCA8 polyclonal antibody

ABCA8 polyclonal antibody

Ref: AB-PAB24373
ABCA8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ABCA8.
Información adicional
Size 100 uL
Gene Name ABCA8
Gene Alias KIAA0822|MGC163152
Gene Description ATP-binding cassette, sub-family A (ABC1), member 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KEVLGLPDEESIKEFTANYPEEIVRVTFTNTYSYHLKFLLGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ABCA8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10351
Iso type IgG

Enviar uma mensagem


ABCA8 polyclonal antibody

ABCA8 polyclonal antibody