TMEM2 polyclonal antibody
  • TMEM2 polyclonal antibody

TMEM2 polyclonal antibody

Ref: AB-PAB24370
TMEM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM2.
Información adicional
Size 100 uL
Gene Name TMEM2
Gene Alias -
Gene Description transmembrane protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq YATDSRGHSPAFLQPQNGNSRHPSGYVPGKVVPLRPPPPPKSQASAKFTSIRREDRATFAFSPEEQQAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23670
Iso type IgG

Enviar uma mensagem


TMEM2 polyclonal antibody

TMEM2 polyclonal antibody