MYEOV2 polyclonal antibody
  • MYEOV2 polyclonal antibody

MYEOV2 polyclonal antibody

Ref: AB-PAB24367
MYEOV2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYEOV2.
Información adicional
Size 100 uL
Gene Name MYEOV2
Gene Alias -
Gene Description myeloma overexpressed 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ATSEGKMGTGRLRNSLRKNQSKWLGSYLEVLRTTRSRREVSEDSTISVSTHWRGKCFKSDETPSVAGGEEGKKTTQPC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYEOV2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 150678
Iso type IgG

Enviar uma mensagem


MYEOV2 polyclonal antibody

MYEOV2 polyclonal antibody