CLCN3 polyclonal antibody
  • CLCN3 polyclonal antibody

CLCN3 polyclonal antibody

Ref: AB-PAB24356
CLCN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLCN3.
Información adicional
Size 100 uL
Gene Name CLCN3
Gene Alias CLC3|ClC-3
Gene Description chloride channel 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLCN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1182
Iso type IgG

Enviar uma mensagem


CLCN3 polyclonal antibody

CLCN3 polyclonal antibody