TIGD6 polyclonal antibody
  • TIGD6 polyclonal antibody

TIGD6 polyclonal antibody

Ref: AB-PAB24346
TIGD6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TIGD6.
Información adicional
Size 100 uL
Gene Name TIGD6
Gene Alias DKFZp761E2110
Gene Description tigger transposable element derived 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MLGYDNFQASVGWLNRFRDRHGIALKAVCREDSDRLMNGLGIDKINEWHAGEIIKLIADYSPDDIFNADETGVFFQLLPQHTLAAKGDHCRGGKKAKQRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TIGD6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81789
Iso type IgG

Enviar uma mensagem


TIGD6 polyclonal antibody

TIGD6 polyclonal antibody