MEIG1 polyclonal antibody
  • MEIG1 polyclonal antibody

MEIG1 polyclonal antibody

Ref: AB-PAB24345
MEIG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MEIG1.
Información adicional
Size 100 uL
Gene Name MEIG1
Gene Alias bA2K17.3
Gene Description meiosis expressed gene 1 homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MASSDVKPTSVSHAKKWSEEIENLYRFQQAGYRDETEYRQVKQVSMVDRWPETGYVKKLQRRDNTFYYYNKQRECDDKEVHKVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MEIG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 644890
Iso type IgG

Enviar uma mensagem


MEIG1 polyclonal antibody

MEIG1 polyclonal antibody