STATH polyclonal antibody
  • STATH polyclonal antibody

STATH polyclonal antibody

Ref: AB-PAB24343
STATH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STATH.
Información adicional
Size 100 uL
Gene Name STATH
Gene Alias STR
Gene Description statherin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STATH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6779
Iso type IgG

Enviar uma mensagem


STATH polyclonal antibody

STATH polyclonal antibody