KIAA1324L polyclonal antibody
  • KIAA1324L polyclonal antibody

KIAA1324L polyclonal antibody

Ref: AB-PAB24341
KIAA1324L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1324L.
Información adicional
Size 100 uL
Gene Name KIAA1324L
Gene Alias EIG121L|FLJ31340
Gene Description KIAA1324-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHIIFKNATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGVASSCRACALGSEQSGSSCVPCPPGHYIEKETNQCKECPPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1324L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222223
Iso type IgG

Enviar uma mensagem


KIAA1324L polyclonal antibody

KIAA1324L polyclonal antibody