RTN4RL1 polyclonal antibody
  • RTN4RL1 polyclonal antibody

RTN4RL1 polyclonal antibody

Ref: AB-PAB24333
RTN4RL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RTN4RL1.
Información adicional
Size 100 uL
Gene Name RTN4RL1
Gene Alias DKFZp547J144|NGRH2|NgR3
Gene Description reticulon 4 receptor-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RTN4RL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146760
Iso type IgG

Enviar uma mensagem


RTN4RL1 polyclonal antibody

RTN4RL1 polyclonal antibody