UTP23 polyclonal antibody
  • UTP23 polyclonal antibody

UTP23 polyclonal antibody

Ref: AB-PAB24330
UTP23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UTP23.
Información adicional
Size 100 uL
Gene Name UTP23
Gene Alias C8orf53|MGC14595
Gene Description UTP23, small subunit (SSU) processome component, homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UTP23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84294
Iso type IgG

Enviar uma mensagem


UTP23 polyclonal antibody

UTP23 polyclonal antibody