CASD1 polyclonal antibody
  • CASD1 polyclonal antibody

CASD1 polyclonal antibody

Ref: AB-PAB24327
CASD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CASD1.
Información adicional
Size 100 uL
Gene Name CASD1
Gene Alias C7orf12|FLJ21213|FLJ21879|FLJ41901|NBLA04196
Gene Description CAS1 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQDPVYEDLLSENRKMITNEKIDAY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CASD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64921
Iso type IgG

Enviar uma mensagem


CASD1 polyclonal antibody

CASD1 polyclonal antibody